PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_05508A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family EIL
Protein Properties Length: 471aa    MW: 52578.5 Da    PI: 5.0881
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_05508AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3175.94.1e-54391641127
                                XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                       EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpv 84 
                                eel +rmwkd+++l+r+ker+++l   ++a++++ +++  ++qa rkk+sra DgiLkYM+k mevcna+GfvYgiip+kgkpv
  Oropetium_20150105_05508A  39 EELARRMWKDRVRLRRIKERQQRLA-LQQAELEKLRQKPVSDQALRKKISRAHDGILKYMIKLMEVCNARGFVYGIIPDKGKPV 121
                                8********************9865.66667***************************************************** PP

                                XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.. CS
                       EIN3  85 egasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqt 127
                                +gasd++raWWkekv+fd+ngpaai+ky+++n+++++++s  +
  Oropetium_20150105_05508A 122 SGASDNIRAWWKEKVKFDKNGPAAIAKYESENMVAANAQSTGV 164
                                ***********************************99988755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048736.9E-5439165No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MEQLAMIATT ELGDSSDLEV EGIQNLNEND VSDEEIEPEE LARRMWKDRV RLRRIKERQQ  60
RLALQQAELE KLRQKPVSDQ ALRKKISRAH DGILKYMIKL MEVCNARGFV YGIIPDKGKP  120
VSGASDNIRA WWKEKVKFDK NGPAAIAKYE SENMVAANAQ STGVKKGRYG ETYNSSNEYD  180
VDGFEDAPLS TSSKDEQDLS PVVQSPEEHA RKKGREMAYK RSNQIVPNKV GTKEQIKTKR  240
ARHNSTVIES EAHRIVDAPE NSRNMIPDMN RQGQLETPVM ANQIVSFNHG DHTTDAFQHR  300
GDAQVQVHLP GTEVNSFGNT QAADATPVST YIGGQHLPYQ NSDITRSKSG NAFPFDATSS  360
LNNLPSSYQS LPPKQSLPLS MMDHHEVPVG TRAPADNSPY SDHMIDGDNP TSVPGDMQQF  420
IDYPFYGEQD KFVGSSFEGL PLDYISISSP IPDINDLLLH EDDLMEYLGT *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00649PBMTransfer from LOC_Os09g31400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001136524.11e-138uncharacterized protein LOC100216639
RefseqXP_008650967.11e-135PREDICTED: uncharacterized protein LOC100216639 isoform X1
TrEMBLA0A0A9DKK81e-147A0A0A9DKK8_ARUDO; Uncharacterized protein
STRINGGRMZM2G006752_P021e-135(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37203779
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.12e-52ETHYLENE-INSENSITIVE3-like 3